Tag: fund recovery

  • Forensic Brief: Limitra Capital – Cryptocule Casefile

    Forensic Brief: Limitra Capital – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Limitra Capital at https: leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Limitra Capital  ·  Domain on record: https:  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Limitra Capital runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, https: either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Limitra Capital ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Limitra Capital introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Limitra Capital climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Limitra Capital demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Limitra Capital can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Limitra Capital has been flagged as a fake broker/platform by IOSCO I-SCAN (Australia – Australian Securities and Investments Commission). reported 2026-04-24. Jurisdiction: Australia. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Limitra Capital, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Recovery Dossier on Tasman (Imposter) – Where the Funds Routed

    Recovery Dossier on Tasman (Imposter) – Where the Funds Routed

    // FORENSIC BRIEF

    If you funded Tasman (Imposter) at tasmanltd.com, the on-chain trail does not vanish when the website does. Cryptocule's brief on Tasman (Imposter) maps that trail wallet by wallet so a recovery filing can be built on documented evidence, not allegation.

    Platform: Tasman (Imposter)  ·  Domain on record: tasmanltd.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    Claimants who pay Tasman (Imposter) in cryptocurrency are usually offered BTC, ETH, USDT-TRC20, or all three. The operational reality is a forwarding wallet per chain collecting inbound flow into a single off-ramp – in most cases a centralised exchange registered in a jurisdiction that does not auto-honour freeze requests from US, UK, or EU agencies. The Cryptocule trail audit turns those deposit hashes into a documented graph that a federal intake desk, a state attorney general's office, or an exchange compliance team can move on.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Tasman (Imposter) introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Tasman (Imposter) climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Tasman (Imposter) demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – off-ramp leverage

    Where Tasman (Imposter) routes claimant funds to a regulated centralised exchange, the recovery move is the same: a documented IC3 filing for US claimants, a state-AG complaint where the loss meets state thresholds, and a chain-analytics-backed evidence packet sent to the exchange's compliance desk. The exchange has a regulated obligation to respond – that is the leverage the trail audit produces.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Tasman (Imposter) has been flagged as a fake broker/platform by IOSCO I-SCAN (New Zealand – Financial Markets Authority). reported 2025-05-09. Jurisdiction: New Zealand. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Forensic Brief: Rave Fx Trades – Cryptocule Casefile

    Forensic Brief: Rave Fx Trades – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Rave Fx Trades at ravefxtrades.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Rave Fx Trades  ·  Domain on record: ravefxtrades.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Rave Fx Trades runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, ravefxtrades.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Rave Fx Trades ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Rave Fx Trades introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Rave Fx Trades climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Rave Fx Trades demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Rave Fx Trades can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Rave Fx Trades has been flagged as a fake broker/platform by IOSCO I-SCAN (United States of America – Securities and Exchange Commission). reported 2026-06-04. Jurisdiction: United States of America. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Rave Fx Trades, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Recovery Dossier on Cuarto – Where the Funds Routed

    Recovery Dossier on Cuarto – Where the Funds Routed

    // FORENSIC BRIEF

    If you funded Cuarto at cuarto.capital, the on-chain trail does not vanish when the website does. Cryptocule's brief on Cuarto maps that trail wallet by wallet so a recovery filing can be built on documented evidence, not allegation.

    Platform: Cuarto  ·  Domain on record: cuarto.capital  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    Claimants who pay Cuarto in cryptocurrency are usually offered BTC, ETH, USDT-TRC20, or all three. The operational reality is a forwarding wallet per chain collecting inbound flow into a single off-ramp – in most cases a centralised exchange registered in a jurisdiction that does not auto-honour freeze requests from US, UK, or EU agencies. The Cryptocule trail audit turns those deposit hashes into a documented graph that a federal intake desk, a state attorney general's office, or an exchange compliance team can move on.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Cuarto introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Cuarto climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Cuarto demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – off-ramp leverage

    Where Cuarto routes claimant funds to a regulated centralised exchange, the recovery move is the same: a documented IC3 filing for US claimants, a state-AG complaint where the loss meets state thresholds, and a chain-analytics-backed evidence packet sent to the exchange's compliance desk. The exchange has a regulated obligation to respond – that is the leverage the trail audit produces.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Cuarto has been flagged as a fake broker/platform by IOSCO I-SCAN (Spain – Comisión Nacional del Mercado de Valores). reported 2023-05-16. Jurisdiction: Spain. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Why a Investrix Ai Recovery Filing Holds – Cryptocule Brief

    Why a Investrix Ai Recovery Filing Holds – Cryptocule Brief

    // FORENSIC BRIEF

    Claimants who funded Investrix Ai (www.investrix-ai.net) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Investrix Ai  ·  Domain on record: www.investrix-ai.net  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching www.investrix-ai.net ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – Investrix Ai fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name www.investrix-ai.net carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at www.investrix-ai.net disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, Investrix Ai doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Investrix Ai can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Investrix Ai has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2025-08-14. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Why a Akoue Recovery Filing Holds – Cryptocule Brief

    Why a Akoue Recovery Filing Holds – Cryptocule Brief

    // FORENSIC BRIEF

    Claimants who funded Akoue (akoue.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Akoue  ·  Domain on record: akoue.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching akoue.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – Akoue fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name akoue.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at akoue.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, Akoue doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Akoue can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Akoue has been flagged as a Credit fraud by FSMA Belgium. FSMA warning 27/03/2023. Jurisdiction: BE. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.fsma.be/en/warnings/companies-operating-unlawfully-in-belgium

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Interersos Wallet Pathway – Trail Audit by Cryptocule

    Interersos Wallet Pathway – Trail Audit by Cryptocule

    // FORENSIC BRIEF

    If you funded Interersos at https:, the on-chain trail does not vanish when the website does. Cryptocule's brief on Interersos maps that trail wallet by wallet so a recovery filing can be built on documented evidence, not allegation.

    Platform: Interersos  ·  Domain on record: https:  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    Claimants who pay Interersos in cryptocurrency are usually offered BTC, ETH, USDT-TRC20, or all three. The operational reality is a forwarding wallet per chain collecting inbound flow into a single off-ramp – in most cases a centralised exchange registered in a jurisdiction that does not auto-honour freeze requests from US, UK, or EU agencies. The Cryptocule trail audit turns those deposit hashes into a documented graph that a federal intake desk, a state attorney general's office, or an exchange compliance team can move on.

    Operational tells (Set C)

    • absent from every public registry checked – Interersos fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name https: carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at https: disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, Interersos doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Interersos can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Interersos has been flagged as a fake broker/platform by IOSCO I-SCAN (Italy – Commissione Nazionale per le Società e la Borsa). reported 2025-07-29. Jurisdiction: Italy. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Begin a recovery audit. Free, no retainer, real analyst on the other end.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Recovery Dossier on CFX Markets Global – Where the Funds Routed

    Recovery Dossier on CFX Markets Global – Where the Funds Routed

    // FORENSIC BRIEF

    If you funded CFX Markets Global at cfxmarketsglobal.com, the on-chain trail does not vanish when the website does. Cryptocule's brief on CFX Markets Global maps that trail wallet by wallet so a recovery filing can be built on documented evidence, not allegation.

    Platform: CFX Markets Global  ·  Domain on record: cfxmarketsglobal.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    Claimants who pay CFX Markets Global in cryptocurrency are usually offered BTC, ETH, USDT-TRC20, or all three. The operational reality is a forwarding wallet per chain collecting inbound flow into a single off-ramp – in most cases a centralised exchange registered in a jurisdiction that does not auto-honour freeze requests from US, UK, or EU agencies. The Cryptocule trail audit turns those deposit hashes into a documented graph that a federal intake desk, a state attorney general's office, or an exchange compliance team can move on.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees CFX Markets Global introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by CFX Markets Global climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, CFX Markets Global demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – off-ramp leverage

    Where CFX Markets Global routes claimant funds to a regulated centralised exchange, the recovery move is the same: a documented IC3 filing for US claimants, a state-AG complaint where the loss meets state thresholds, and a chain-analytics-backed evidence packet sent to the exchange's compliance desk. The exchange has a regulated obligation to respond – that is the leverage the trail audit produces.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    CFX Markets Global has been flagged as a fake broker/platform by IOSCO I-SCAN (United States of America – Securities and Exchange Commission). reported 2026-06-04. Jurisdiction: United States of America. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Forensic Brief: Illuminate Trade – Cryptocule Casefile

    Forensic Brief: Illuminate Trade – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Illuminate Trade at illuminatetrade.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Illuminate Trade  ·  Domain on record: illuminatetrade.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Illuminate Trade runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, illuminatetrade.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Illuminate Trade ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Illuminate Trade introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Illuminate Trade climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Illuminate Trade demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Illuminate Trade can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Illuminate Trade has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2026-01-16. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Illuminate Trade, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Forensic Brief: Tradeview Financial Markets SAC – Cryptocule Casefile

    Forensic Brief: Tradeview Financial Markets SAC – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Tradeview Financial Markets SAC at tradeviewfinancialmarketssac.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Tradeview Financial Markets SAC  ·  Domain on record: tradeviewfinancialmarketssac.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Tradeview Financial Markets SAC runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, tradeviewfinancialmarketssac.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Tradeview Financial Markets SAC ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Tradeview Financial Markets SAC introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Tradeview Financial Markets SAC climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Tradeview Financial Markets SAC demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Tradeview Financial Markets SAC can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Tradeview Financial Markets SAC has been flagged as a fake broker/platform by IOSCO I-SCAN (Ukraine – National Securities and Stock Market Commission). reported 2024-06-28. Jurisdiction: Ukraine. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Tradeview Financial Markets SAC, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ