Tag: fund recovery

  • Forensic Brief: Tradeview Financial Markets SAC – Cryptocule Casefile

    Forensic Brief: Tradeview Financial Markets SAC – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Tradeview Financial Markets SAC at tradeviewfinancialmarketssac.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Tradeview Financial Markets SAC  ·  Domain on record: tradeviewfinancialmarketssac.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Tradeview Financial Markets SAC runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, tradeviewfinancialmarketssac.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Tradeview Financial Markets SAC ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Tradeview Financial Markets SAC introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Tradeview Financial Markets SAC climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Tradeview Financial Markets SAC demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Tradeview Financial Markets SAC can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Tradeview Financial Markets SAC has been flagged as a fake broker/platform by IOSCO I-SCAN (Ukraine – National Securities and Stock Market Commission). reported 2024-06-28. Jurisdiction: Ukraine. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Tradeview Financial Markets SAC, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • First Source Investment (firstsourceinvestment.com) – Cryptocule Trail-and-Filing Notes

    First Source Investment (firstsourceinvestment.com) – Cryptocule Trail-and-Filing Notes

    // FORENSIC BRIEF

    Claimants who funded First Source Investment (firstsourceinvestment.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: First Source Investment  ·  Domain on record: firstsourceinvestment.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching firstsourceinvestment.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – First Source Investment fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name firstsourceinvestment.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at firstsourceinvestment.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, First Source Investment doesn't reply – a regulated firm answers in a week.

    Filing pathway – off-ramp leverage

    Where First Source Investment routes claimant funds to a regulated centralised exchange, the recovery move is the same: a documented IC3 filing for US claimants, a state-AG complaint where the loss meets state thresholds, and a chain-analytics-backed evidence packet sent to the exchange's compliance desk. The exchange has a regulated obligation to respond – that is the leverage the trail audit produces.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    First Source Investment has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2024-08-13. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    File a recovery brief – Cryptocule reviews every claim against First Source Investment at no cost to begin.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Why a NordenCrypto Recovery Filing Holds – Cryptocule Brief

    Why a NordenCrypto Recovery Filing Holds – Cryptocule Brief

    // FORENSIC BRIEF

    Claimants who funded NordenCrypto (nordencrypto.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: NordenCrypto  ·  Domain on record: nordencrypto.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching nordencrypto.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – NordenCrypto fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name nordencrypto.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at nordencrypto.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, NordenCrypto doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against NordenCrypto can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    NordenCrypto has been flagged as a fake broker/platform by IOSCO I-SCAN (Switzerland – Swiss Financial Market Supervisory Authority). reported 2024-06-12. Jurisdiction: Switzerland. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Why a Octaloptions Recovery Filing Holds – Cryptocule Brief

    Why a Octaloptions Recovery Filing Holds – Cryptocule Brief

    // FORENSIC BRIEF

    Claimants who funded Octaloptions (octaloption.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Octaloptions  ·  Domain on record: octaloption.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching octaloption.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – Octaloptions fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name octaloption.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at octaloption.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, Octaloptions doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Octaloptions can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Octaloptions has been flagged as a fake broker/platform by IOSCO I-SCAN (Australia – Australian Securities and Investments Commission). reported 2024-02-09. Jurisdiction: Australia. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Casefile Tesla Trader Online Tesla Trader: Deposit Hash to Filing Pathway

    Casefile Tesla Trader Online Tesla Trader: Deposit Hash to Filing Pathway

    // FORENSIC BRIEF

    Claimants who funded Tesla Trader Online Tesla Trader (https:) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Tesla Trader Online Tesla Trader  ·  Domain on record: https:  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Tesla Trader Online Tesla Trader runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, https: either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Tesla Trader Online Tesla Trader ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Tesla Trader Online Tesla Trader introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Tesla Trader Online Tesla Trader climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Tesla Trader Online Tesla Trader demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Tesla Trader Online Tesla Trader can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Tesla Trader Online Tesla Trader has been flagged as a fake broker/platform by IOSCO I-SCAN (British Columbia – British Columbia Securities Commission). reported 2026-06-25. Jurisdiction: British Columbia. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Talk to a real Cryptocule analyst – start at /contact-us/.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Forensic Brief: prénom.nom@corum-epargne.net – Cryptocule Casefile

    Forensic Brief: prénom.nom@corum-epargne.net – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to prénom.nom@corum-epargne.net at prénom.nom@corum-epargne.net leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: prénom.nom@corum-epargne.net  ·  Domain on record: prénom.nom@corum-epargne.net  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about prénom.nom@corum-epargne.net runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, prénom.nom@corum-epargne.net either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address prénom.nom@corum-epargne.net ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees prénom.nom@corum-epargne.net introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by prénom.nom@corum-epargne.net climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, prénom.nom@corum-epargne.net demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against prénom.nom@corum-epargne.net can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    prénom.nom@corum-epargne.net has been flagged as a fake broker/platform by IOSCO I-SCAN (France – Autorité des marchés financiers). reported 2023-02-14. Jurisdiction: France. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded prénom.nom@corum-epargne.net, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Why a Park Foreign Trust Bank Recovery Filing Holds – Cryptocule Brief

    Why a Park Foreign Trust Bank Recovery Filing Holds – Cryptocule Brief

    // FORENSIC BRIEF

    Claimants who funded Park Foreign Trust Bank (parkforeigntrust.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Park Foreign Trust Bank  ·  Domain on record: parkforeigntrust.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching parkforeigntrust.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – Park Foreign Trust Bank fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name parkforeigntrust.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at parkforeigntrust.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, Park Foreign Trust Bank doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Park Foreign Trust Bank can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Park Foreign Trust Bank has been flagged as a fake broker/platform by IOSCO I-SCAN (New Zealand – Financial Markets Authority). reported 2026-03-03. Jurisdiction: New Zealand. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Casefile Yield Moore: Deposit Hash to Filing Pathway

    Casefile Yield Moore: Deposit Hash to Filing Pathway

    // FORENSIC BRIEF

    Claimants who funded Yield Moore (yieldmoore.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Yield Moore  ·  Domain on record: yieldmoore.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Yield Moore runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, yieldmoore.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Yield Moore ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Yield Moore introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Yield Moore climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Yield Moore demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Yield Moore can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Yield Moore has been flagged as a fake broker/platform by IOSCO I-SCAN (New Zealand – Financial Markets Authority). reported 2025-09-01. Jurisdiction: New Zealand. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Talk to a real Cryptocule analyst – start at /contact-us/.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Forensic Brief: Boostkrediet Dienst – Cryptocule Casefile

    Forensic Brief: Boostkrediet Dienst – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Boostkrediet Dienst at boostkredietdienst.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Boostkrediet Dienst  ·  Domain on record: boostkredietdienst.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Boostkrediet Dienst runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, boostkredietdienst.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Boostkrediet Dienst ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Boostkrediet Dienst introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Boostkrediet Dienst climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Boostkrediet Dienst demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Boostkrediet Dienst can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Boostkrediet Dienst has been flagged as a Credit fraud by FSMA Belgium. FSMA warning 11/02/2026. Jurisdiction: BE. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.fsma.be/en/warnings/companies-operating-unlawfully-in-belgium

    If you funded Boostkrediet Dienst, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • FINANZAS CON SHIR (finanzasconshir.com) – Cryptocule Trail-and-Filing Notes

    FINANZAS CON SHIR (finanzasconshir.com) – Cryptocule Trail-and-Filing Notes

    // FORENSIC BRIEF

    Claimants who funded FINANZAS CON SHIR (finanzasconshir.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: FINANZAS CON SHIR  ·  Domain on record: finanzasconshir.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching finanzasconshir.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – FINANZAS CON SHIR fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name finanzasconshir.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at finanzasconshir.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, FINANZAS CON SHIR doesn't reply – a regulated firm answers in a week.

    Filing pathway – off-ramp leverage

    Where FINANZAS CON SHIR routes claimant funds to a regulated centralised exchange, the recovery move is the same: a documented IC3 filing for US claimants, a state-AG complaint where the loss meets state thresholds, and a chain-analytics-backed evidence packet sent to the exchange's compliance desk. The exchange has a regulated obligation to respond – that is the leverage the trail audit produces.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    FINANZAS CON SHIR has been flagged as a fake broker/platform by IOSCO I-SCAN (Argentina – Comisión Nacional de Valores). reported 2023-07-27. Jurisdiction: Argentina. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    File a recovery brief – Cryptocule reviews every claim against FINANZAS CON SHIR at no cost to begin.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ