Cryptocule.com

Tag: crypto scam recovery

  • Rates Checker — report and reference

    Forensic Brief: Rates Checker – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Rates Checker at rateschecker.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Rates Checker  ·  Domain on record: rateschecker.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Rates Checker runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, rateschecker.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Rates Checker ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Rates Checker introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Rates Checker climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Rates Checker demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Rates Checker can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Rates Checker has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2021-10-13. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Rates Checker, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Interersos — report and reference

    Interersos Wallet Pathway – Trail Audit by Cryptocule

    // FORENSIC BRIEF

    If you funded Interersos at https:, the on-chain trail does not vanish when the website does. Cryptocule's brief on Interersos maps that trail wallet by wallet so a recovery filing can be built on documented evidence, not allegation.

    Platform: Interersos  ·  Domain on record: https:  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    Claimants who pay Interersos in cryptocurrency are usually offered BTC, ETH, USDT-TRC20, or all three. The operational reality is a forwarding wallet per chain collecting inbound flow into a single off-ramp – in most cases a centralised exchange registered in a jurisdiction that does not auto-honour freeze requests from US, UK, or EU agencies. The Cryptocule trail audit turns those deposit hashes into a documented graph that a federal intake desk, a state attorney general's office, or an exchange compliance team can move on.

    Operational tells (Set C)

    • absent from every public registry checked – Interersos fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name https: carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at https: disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, Interersos doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Interersos can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Interersos has been flagged as a fake broker/platform by IOSCO I-SCAN (Italy – Commissione Nazionale per le Società e la Borsa). reported 2025-07-29. Jurisdiction: Italy. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Begin a recovery audit. Free, no retainer, real analyst on the other end.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • CFX Markets Global — report and reference

    Recovery Dossier on CFX Markets Global – Where the Funds Routed

    // FORENSIC BRIEF

    If you funded CFX Markets Global at cfxmarketsglobal.com, the on-chain trail does not vanish when the website does. Cryptocule's brief on CFX Markets Global maps that trail wallet by wallet so a recovery filing can be built on documented evidence, not allegation.

    Platform: CFX Markets Global  ·  Domain on record: cfxmarketsglobal.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    Claimants who pay CFX Markets Global in cryptocurrency are usually offered BTC, ETH, USDT-TRC20, or all three. The operational reality is a forwarding wallet per chain collecting inbound flow into a single off-ramp – in most cases a centralised exchange registered in a jurisdiction that does not auto-honour freeze requests from US, UK, or EU agencies. The Cryptocule trail audit turns those deposit hashes into a documented graph that a federal intake desk, a state attorney general's office, or an exchange compliance team can move on.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees CFX Markets Global introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by CFX Markets Global climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, CFX Markets Global demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – off-ramp leverage

    Where CFX Markets Global routes claimant funds to a regulated centralised exchange, the recovery move is the same: a documented IC3 filing for US claimants, a state-AG complaint where the loss meets state thresholds, and a chain-analytics-backed evidence packet sent to the exchange's compliance desk. The exchange has a regulated obligation to respond – that is the leverage the trail audit produces.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    CFX Markets Global has been flagged as a fake broker/platform by IOSCO I-SCAN (United States of America – Securities and Exchange Commission). reported 2026-06-04. Jurisdiction: United States of America. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Code Patrimoine — report and reference

    Casefile Code Patrimoine: Deposit Hash to Filing Pathway

    // FORENSIC BRIEF

    Claimants who funded Code Patrimoine (www.code-patrimoine.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Code Patrimoine  ·  Domain on record: www.code-patrimoine.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Code Patrimoine runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, www.code-patrimoine.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Code Patrimoine ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Code Patrimoine introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Code Patrimoine climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Code Patrimoine demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Code Patrimoine can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Code Patrimoine has been flagged as a fake broker/platform by IOSCO I-SCAN (France – Autorité des marchés financiers). reported 2020-03-19. Jurisdiction: France. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Talk to a real Cryptocule analyst – start at /contact-us/.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Illuminate Trade — report and reference

    Forensic Brief: Illuminate Trade – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Illuminate Trade at illuminatetrade.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Illuminate Trade  ·  Domain on record: illuminatetrade.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Illuminate Trade runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, illuminatetrade.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Illuminate Trade ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Illuminate Trade introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Illuminate Trade climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Illuminate Trade demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Illuminate Trade can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Illuminate Trade has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2026-01-16. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Illuminate Trade, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Tradeview Financial Markets SAC — report and reference

    Forensic Brief: Tradeview Financial Markets SAC – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to Tradeview Financial Markets SAC at tradeviewfinancialmarketssac.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: Tradeview Financial Markets SAC  ·  Domain on record: tradeviewfinancialmarketssac.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about Tradeview Financial Markets SAC runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, tradeviewfinancialmarketssac.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address Tradeview Financial Markets SAC ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees Tradeview Financial Markets SAC introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by Tradeview Financial Markets SAC climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, Tradeview Financial Markets SAC demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Tradeview Financial Markets SAC can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Tradeview Financial Markets SAC has been flagged as a fake broker/platform by IOSCO I-SCAN (Ukraine – National Securities and Stock Market Commission). reported 2024-06-28. Jurisdiction: Ukraine. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded Tradeview Financial Markets SAC, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • best ethical options — report and reference

    Forensic Brief: best ethical options – Cryptocule Casefile

    // FORENSIC BRIEF

    Funds sent to best ethical options at bestethicaloptions.com leave a trail that no website takedown can erase. The Cryptocule trail audit converts that on-chain history into evidence that survives the platform disappearing.

    Platform: best ethical options  ·  Domain on record: bestethicaloptions.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    The repeating arc reported about best ethical options runs roughly the same way: a contact opens through a private channel; a modest first deposit is accepted with a polished confirmation; the in-platform number rises while the claimant is still measuring trust; then a top-up is demanded before any withdrawal will move. By the moment the off-ramp request is filed seriously, bestethicaloptions.com either disappears or invents a fresh fee. Sites can be taken down. The on-chain history cannot. Every deposit address best ethical options ever issued is still on the public ledger – that record is the substrate a Cryptocule casefile gets assembled on top of.

    Operational tells (Set B)

    • private-channel onboarding – Cryptocule sees best ethical options introduce itself through Telegram threads, WhatsApp groups, Instagram DMs, or dating-app handoffs – not the channels a chartered firm would use.
    • monotonic equity curve – The in-platform balance plotted by best ethical options climbs without natural pullbacks; that is a script generating a chart, not a market generating a price.
    • release-fee gate at withdrawal – Once a withdrawal request is filed, best ethical options demands a fresh deposit dressed as 'clearance', 'unlock', or 'liquidity bond' – no regulated venue holds payouts behind a fresh wire.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against best ethical options can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    best ethical options has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2022-09-27. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    If you funded best ethical options, the trail can still be mapped. Open a free case evaluation now.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • First Source Investment — report and reference

    First Source Investment (firstsourceinvestment.com) – Cryptocule Trail-and-Filing Notes

    // FORENSIC BRIEF

    Claimants who funded First Source Investment (firstsourceinvestment.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: First Source Investment  ·  Domain on record: firstsourceinvestment.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching firstsourceinvestment.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – First Source Investment fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name firstsourceinvestment.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at firstsourceinvestment.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, First Source Investment doesn't reply – a regulated firm answers in a week.

    Filing pathway – off-ramp leverage

    Where First Source Investment routes claimant funds to a regulated centralised exchange, the recovery move is the same: a documented IC3 filing for US claimants, a state-AG complaint where the loss meets state thresholds, and a chain-analytics-backed evidence packet sent to the exchange's compliance desk. The exchange has a regulated obligation to respond – that is the leverage the trail audit produces.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    First Source Investment has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2024-08-13. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    File a recovery brief – Cryptocule reviews every claim against First Source Investment at no cost to begin.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • NordenCrypto — report and reference

    Why a NordenCrypto Recovery Filing Holds – Cryptocule Brief

    // FORENSIC BRIEF

    Claimants who funded NordenCrypto (nordencrypto.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: NordenCrypto  ·  Domain on record: nordencrypto.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching nordencrypto.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – NordenCrypto fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name nordencrypto.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at nordencrypto.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, NordenCrypto doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against NordenCrypto can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    NordenCrypto has been flagged as a fake broker/platform by IOSCO I-SCAN (Switzerland – Swiss Financial Market Supervisory Authority). reported 2024-06-12. Jurisdiction: Switzerland. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ

  • Insight Financial Limited (Clone of FCA Authorised firm) — report and reference

    Why a Insight Financial Limited (Clone of FCA Authorised firm) Recovery Filing Holds – Cryptocule Brief

    // FORENSIC BRIEF

    Claimants who funded Insight Financial Limited (Clone of FCA Authorised firm) (insightfinanciallimitedcloneoffcaauthorisedfirm.com) and were then asked for a 'release fee', a 'tax clearance', or a 'liquidity bond' will recognise the pattern – and so do we. Cryptocule documents it and files against it.

    Platform: Insight Financial Limited (Clone of FCA Authorised firm)  ·  Domain on record: insightfinanciallimitedcloneoffcaauthorisedfirm.com  ·  Cryptocule read: recovery is pursued through wallet-trace + filing, not negotiation with the operator.

    Wallet Trace

    What separates a Cryptocule trail audit from a generic 'recovery service' pitch is what arrives at the end. The audit ends with a packet: deposit hashes, forwarding wallets, the timestamped off-ramp transaction, screenshots preserved with chain-of-custody hashes, the matching insightfinanciallimitedcloneoffcaauthorisedfirm.com ToS pages, and a recommended filing pathway – not a vague promise. That packet is what a regulator or a chain-analytics counterparty actually needs.

    Operational tells (Set C)

    • absent from every public registry checked – Insight Financial Limited (Clone of FCA Authorised firm) fails lookup against the FCA register, SEC IAPD, FINRA BrokerCheck, and the NASAA-member state lists under the corporate name insightfinanciallimitedcloneoffcaauthorisedfirm.com carries.
    • conflicting jurisdiction disclosures – Privacy page, ToS, and footer at insightfinanciallimitedcloneoffcaauthorisedfirm.com disagree on governing jurisdiction – the textbook signature of a paper-shell operator.
    • ignored audit-trail requests – When asked in writing for proof of segregated accounts, an auditor letter, or an AML registration number, Insight Financial Limited (Clone of FCA Authorised firm) doesn't reply – a regulated firm answers in a week.

    Filing pathway – civil discovery overlay

    Where the dollar value justifies it, the on-chain trail Cryptocule produces against Insight Financial Limited (Clone of FCA Authorised firm) can be lifted into a civil discovery filing – subpoena directed at the receiving exchange for KYC on the off-ramp wallet. That is how a chain trail converts to an identified counterparty.

    What Cryptocule tracks

    Cryptocule traces across Bitcoin, Ethereum, Tron (USDT-TRC20), BNB Smart Chain, Polygon, Arbitrum, Optimism, Avalanche, and the bridges that link them. Off-ramps tracked include Binance, Bybit, OKX, Kraken, Coinbase, Crypto.com, KuCoin, Gate.io, Huobi, Bitfinex, MEXC, and the smaller venues those rotate through under stress.

    Lines we don’t cross

    Cryptocule will not request seed phrases, will not ask for remote-access logins to your wallet, will not take an upfront cash retainer before scoping a case, and will not promise a guaranteed recovery. A real analyst will scope the matter free and tell you in writing whether the trail justifies a filing.

    Regulator and warning-list notes

    Insight Financial Limited (Clone of FCA Authorised firm) has been flagged as a fake broker/platform by IOSCO I-SCAN (United Kingdom – Financial Conduct Authority). reported 2021-04-20. Jurisdiction: United Kingdom. It appears on an official regulator or fraud-warning list, which is a strong indicator of a scam operation. Treat any contact from this entity with caution. Reference: https://www.iosco.org/i-scan/

    Submit your wallet for a forensic trace at /submit-a-case/ – no upfront fees, no automated chatbot.

    Open a Free Case Evaluation   Submit Wallet for Trace

    Internal: Wallet Check · How We Recover · FAQ